HORDB

ID: hor005558
Uniprot ID: D2Z1D6
Protein name: Pigment-dispersing hormone
Gene name: PDH
Organism: Armadillidium vulgare (Pillbug) (Pill woodlouse)
Family: Arthropod PDH family
Source: animal
Expression: Expressed strongly in the head and weakly in the ventral nerve cord. Not detected in the midgut cecum or hindgut. In the cephalic neural complex, specifically localized to cells within the optic lobe, anteromedian protocerebrum, accessory lobe, tritocereb
Disease: NA
Comments: NA
Taxonomy: Armadillidium (genus), Armadillidiidae (family), Crinocheta, Oniscidea (suborder), Isopoda (order), Peracarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0009416 response to light stimulus
GO CC: GO:0005576 extracellular region; GO:0045202 synapse

Sequence: NSELINSLLGAPRVLNNA
Length: 18(63-80)
Propeptide: MIGKYLSWFMLAFLFGFVLESYRVQSQDLNPTEKEVLSNMLDFLQRHSRTTYMFPLLSESKRNSELINSLLGAPRVLNNAGR
Signal peptide: MIGKYLSWFMLAFLFGFVLESYRVQS
Modification: T18 Alanine amide
Glycosylation: NA
Mutagenesis: NA

Function: The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neurom
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005558_AF2.pdb

hor005558_ESM.pdb

Mass:	219856	Formula:	C81H139N25O27
Absent amino acids:	CDFHKMQTWY	Common amino acids:	LN
pI:	6.41	Basic residues:	1
Polar residues:	7	Hydrophobic residues:	8
Hydrophobicity:	10.56	Boman Index:	-2189
Half-Life:	1.4 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	135.56
Instability Index:	2093.89	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 20637211
Title: Precursor structure, distribution and possible functions of pigment-dispersing hormone (PDH) in the terrestrial isopod Armadillidium vulgare (Latreille)